HPA004480

antibody from Atlas Antibodies

Targeting: AFG3L2 SCA28, SPAX5

Antibody data

Submit

Validation data

Product number: HPA004480 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA004480, RRID:AB_1078108
Product name: Anti-AFG3L2
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: DKLARKLASLTPGFSGADVANVCNEAALIAARHLS DSINQKHFEQAIERVIGGLEKKTQVLQPEEKKTVA YHEAGHAVAGWYLEHADPLLKVSIIPRGKGLGYAQ YLPKEQYLYTKEQLLDRMCMTLGGRVSEEIFFGRI TTGAQDD
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

AFG3L2 protein structure - HPA004480 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human colon, kidney, liver and testis using Anti-AFG3L2 antibody HPA004480 (A) shows similar protein distribution across tissues to independent antibody HPA004479 (B).
Antibody #2 product nr: HPA004479
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human duodenum shows strong cytoplasmic positivity in glandular cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-AFG3L2 antibody HPA004480.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-AFG3L2 antibody HPA004480.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis using Anti-AFG3L2 antibody HPA004480.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver using Anti-AFG3L2 antibody HPA004480.
Sample type: HUMAN