Explore
Validate
Learn
Western blot
ImmunocytochemistryAntibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA005448 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA005448, RRID:AB_1079738
- Product name
- Anti-RAD17
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
SKEHGIQVQEWINPVLPDFQKDDFKGMFNTESSFH
MFPYQSQIAVFKEFLLRATKYNKLQMLGDDLRTDK
KIILVEDLPNQFYRDSHTLHEVLRKYVRIGRCPLI
FIISDSLSGDNNQRLLFPKEIQEECSISNISFNPV
AP- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells
Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model.
Stadler C, Rexhepaj E, Singan V, Murphy R, Pepperkok R, Uhlén M, Simpson J, Lundberg E
Nature Methods 2013 February;10(4):315-323
Nature Methods 2013 February;10(4):315-323
Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model.
Kato BS, Nicholson G, Neiman M, Rantalainen M, Holmes CC, Barrett A, Uhlén M, Nilsson P, Spector TD, Schwenk JM
Proteome science 2011 Nov 17;9:73
Proteome science 2011 Nov 17;9:73
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Recombinant expression validation
- Main image
- Experimental details
- Western blot analysis in control (vector only transfected HEK293T lysate) and RAD17 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY403335).
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows strong nuclear positivity in cells in seminiferus ducts.
- Sample type
- HUMAN
