Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000392-A01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000392-A01, RRID:AB_462370
- Product name
- ARHGAP1 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant ARHGAP1.
- Antigen sequence
GFLNIDESQRVPATLQVLQTLPEENYQVLRFLTAF
LVQISAHSDQNKMTNTNLAVVFGPNLLWAKDAAIT
LKAINPINTFTKFLLDHQGELFPSPDPSGL- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Two-tiered approach identifies a network of cancer and liver disease-related genes regulated by miR-122.
Cdo promotes neuronal differentiation via activation of the p38 mitogen-activated protein kinase pathway.
A Cdo-Bnip-2-Cdc42 signaling pathway regulates p38alpha/beta MAPK activity and myogenic differentiation.
Boutz DR, Collins PJ, Suresh U, Lu M, RamÃrez CM, Fernández-Hernando C, Huang Y, Abreu Rde S, Le SY, Shapiro BA, Liu AM, Luk JM, Aldred SF, Trinklein ND, Marcotte EM, Penalva LO
The Journal of biological chemistry 2011 May 20;286(20):18066-78
The Journal of biological chemistry 2011 May 20;286(20):18066-78
Cdo promotes neuronal differentiation via activation of the p38 mitogen-activated protein kinase pathway.
Oh JE, Bae GU, Yang YJ, Yi MJ, Lee HJ, Kim BG, Krauss RS, Kang JS
FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2009 Jul;23(7):2088-99
FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2009 Jul;23(7):2088-99
A Cdo-Bnip-2-Cdc42 signaling pathway regulates p38alpha/beta MAPK activity and myogenic differentiation.
Kang JS, Bae GU, Yi MJ, Yang YJ, Oh JE, Takaesu G, Zhou YT, Low BC, Krauss RS
The Journal of cell biology 2008 Aug 11;182(3):497-507
The Journal of cell biology 2008 Aug 11;182(3):497-507
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- ARHGAP1 polyclonal antibody (A01), Lot # ABNOVA060629QCS1. Western Blot analysis of ARHGAP1 expression in Raw 264.7.