Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310573 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Glucuronidase, beta (GUSB) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-GUSB antibody: synthetic peptide directed towards the C terminal of human GUSB
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Zebrafish
- Host
- Rabbit
- Antigen sequence
VLGNKKGIFTRQRQPKSAAFLLRERYWKIANETRY
PHSVA KSQCLENSPF- Epitope
- C-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Developmentally regulated mannose 6-phosphate receptor-mediated transport of a lysosomal enzyme across the blood-brain barrier.
Urayama A, Grubb JH, Sly WS, Banks WA
Proceedings of the National Academy of Sciences of the United States of America 2004 Aug 24;101(34):12658-63
Proceedings of the National Academy of Sciences of the United States of America 2004 Aug 24;101(34):12658-63
No comments: Submit comment
No validations: Submit validation data