PAB20394

ABCA3 antibody from Abnova Corporation
ABC-C, ABC3, EST111653, LBM180

Antibody data

Product number
PAB20394
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB20394, RRID:AB_10963748
Product name
ABCA3 polyclonal antibody
Provider product page
Abnova Corporation - PAB20394
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant ABCA3.
Antigen sequence
MLRLTLGEYGRTVVPFSVPGTSQLGQQLSEHLKDA
LQAEGQEPREVLGDLEEFLIFRASVEGGGFNERCL
VAASFRDVGERTVVNALFNNQAYHSPATALAVVDN
LLFKLLCGPHASIVVSNFPQPRSALQAAKDQFNEG
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -