HPA007884

antibody from Atlas Antibodies

Targeting: ABCA3 ABC-C, ABC3, EST111653, LBM180

Antibody data

Submit

Validation data

Product number: HPA007884 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA007884, RRID:AB_1078077
Product name: Anti-ABCA3
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: MLRLTLGEYGRTVVPFSVPGTSQLGQQLSEHLKDA LQAEGQEPREVLGDLEEFLIFRASVEGGGFNERCL VAASFRDVGERTVVNALFNNQAYHSPATALAVVDN LLFKLLCGPHASIVVSNFPQPRSALQAAKDQFNEG
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

ABCA3 protein structure - HPA007884 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human lung and liver tissues using HPA007884 antibody. Corresponding ABCA3 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lung shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lung shows strong positivity in pneumocytes.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebellum shows positivity in Purkinje cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows weak cytoplasmic positivity in hepatocytes.
Sample type: HUMAN