Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN184087 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-DAZ Associated Protein 1 (DAZAP1) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-DAZAP1 antibody: synthetic peptide directed towards the C terminal of human DAZAP1
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
QAAPDMSKPPTAQPDFPYGQYGLGSYSPAPPGCGP
HFVYS LMVRLSSDVA- Vial size
- 50 µg
Submitted references Human proteins that specifically bind to 8-oxoguanine-containing RNA and their responses to oxidative stress.
Binding of DAZAP1 and hnRNPA1/A2 to an exonic splicing silencer in a natural BRCA1 exon 18 mutant.
Expression patterns of the DAZ-associated protein DAZAP1 in rat and human ovaries.
Hayakawa H, Fujikane A, Ito R, Matsumoto M, Nakayama KI, Sekiguchi M
Biochemical and biophysical research communications 2010 Dec 10;403(2):220-4
Biochemical and biophysical research communications 2010 Dec 10;403(2):220-4
Binding of DAZAP1 and hnRNPA1/A2 to an exonic splicing silencer in a natural BRCA1 exon 18 mutant.
Goina E, Skoko N, Pagani F
Molecular and cellular biology 2008 Jun;28(11):3850-60
Molecular and cellular biology 2008 Jun;28(11):3850-60
Expression patterns of the DAZ-associated protein DAZAP1 in rat and human ovaries.
Pan HA, Lin YS, Lee KH, Huang JR, Lin YH, Kuo PL
Fertility and sterility 2005 Oct;84 Suppl 2:1089-94
Fertility and sterility 2005 Oct;84 Suppl 2:1089-94
No comments: Submit comment
No validations: Submit validation data