Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00002355-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00002355-M01, RRID:AB_425438
- Product name
- FOSL2 monoclonal antibody (M01), clone 2B4-1C2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant FOSL2.
- Antigen sequence
MSVGLDLPQMLPGSPSPSLKEAFAEDGEAGEGGGR
PSLEWRLQQLLPQHPLSLSWLLTSPQGTGPFLPSV
VICHLLDQVLSLLHSPVPTPVHSSGPGSKQAVNSW
PELSLWLVAHAPFLVVC- Isotype
- IgG
- Antibody clone number
- 2B4-1C2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- FOSL2 monoclonal antibody (M01), clone 2B4-1C2 Western Blot analysis of FOSL2 expression in MCF-7 ( Cat # L046V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- FOSL2 monoclonal antibody (M01), clone 2B4-1C2. Western Blot analysis of FOSL2 expression in Jurkat ( Cat # L017V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged FOSL2 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to FOSL2 on HeLa cell. [antibody concentration 20 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol