Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA006303 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA006303, RRID:AB_1079446
- Product name
- Anti-MYT1
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
EAAPDVIFQEDTSHTSAQKAPELRGPESPSPKPEY
SVIVEVRSDDDKDEDTHSRKSTVTDESEMQDMMTR
GNLGLLEQAIALKAEQVRTVCEPGCPPAEQSQLGL
GEPGKAAKPLDT- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Enhancer Analysis Unveils Genetic Interactions between TLX and SOX2 in Neural Stem Cells and In Vivo Reprogramming.
The Brain-Specific Neural Zinc Finger Transcription Factor 2b (NZF-2b/7ZFMyt1) Suppresses Cocaine Self-Administration in Rats.
The brain-specific Neural Zinc Finger transcription factor 2b (NZF-2b/7ZFMyt1) causes suppression of cocaine-induced locomotor activity
Islam MM, Smith DK, Niu W, Fang S, Iqbal N, Sun G, Shi Y, Zhang CL
Stem cell reports 2015 Nov 10;5(5):805-815
Stem cell reports 2015 Nov 10;5(5):805-815
The Brain-Specific Neural Zinc Finger Transcription Factor 2b (NZF-2b/7ZFMyt1) Suppresses Cocaine Self-Administration in Rats.
Chandrasekar V, Dreyer JL
Frontiers in behavioral neuroscience 2010;4:14
Frontiers in behavioral neuroscience 2010;4:14
The brain-specific Neural Zinc Finger transcription factor 2b (NZF-2b/7ZFMyt1) causes suppression of cocaine-induced locomotor activity
Chandrasekar V, Dreyer J
Neurobiology of Disease 2010 January;37(1):86-98
Neurobiology of Disease 2010 January;37(1):86-98
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line SH-SY5Y shows localization to nucleoplasm & cytosol.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebellum shows moderate nuclear positivity in cells in granular layer.
- Sample type
- HUMAN