HPA019049

CCDC6 antibody from Sigma-Aldrich
D10S170, H4, PTC, TPC, TST1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019049
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019049, RRID:AB_1846163
Product name
Anti-CCDC6 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019049
Antibody type
Polyclonal
Antigen
Coiled-coil domain-containing protein 6 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QPVSAPPSPRDISMEIDSPENMMRHIRFLKNEVER
LKKQLRAAQLQHSEKMAQYLEEERHMREENLRLQR
KLQREMERREALCRQLSESESSLEMDDERYFNEMS
AQGLRPR
Storage
-20C
Provider Type Product Number
- No reagents -