Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [4]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00004172-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00004172-M01, RRID:AB_489994
- Product name
- MCM3 monoclonal antibody (M01), clone 4F7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant MCM3.
- Antigen sequence
AKDGDSYDPYDFSDTEEEMPQVHTPKTADSQETKE
SQKVELSESRLKAFKVALLDVFREAHAQSIGMNRL
TESINRDSEEPFSSVEIQAALSKMQDDNQVMVSEG
IIFLI- Isotype
- IgG
- Antibody clone number
- 4F7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- MCM3 monoclonal antibody (M01), clone 4F7 Western Blot analysis of MCM3 expression in COLO 320 HSR ( Cat # L020V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- MCM3 monoclonal antibody (M01), clone 4F7. Western Blot analysis of MCM3 expression in A-431 ( Cat # L015V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- MCM3 monoclonal antibody (M01), clone 4F7. Western Blot analysis of MCM3 expression in K-562 ( Cat # L009V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- MCM3 monoclonal antibody (M01), clone 4F7. Western Blot analysis of MCM3 expression in Raw 264.7(Cat # L024V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged MCM3 is 0.1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to MCM3 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
