HPA004793

antibody from Atlas Antibodies

Targeting: ARID3A BRIGHT, DRIL1

Antibody data

Submit

Validation data

Product number: HPA004793 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA004793, RRID:AB_1847870
Product name: Anti-ARID3A
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: FGGSLFAYSPGGAHGMLSSPKLPVSSLGLAASTNG SSITPAPKIKKEEDSAIPITVPGRLPVSLAGHPVV AAQAAAVQAAAAQAAVAAQAAALEQLREKLESAEP PEKKMALVADEQQRLMQRALQQ
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

ARID3A protein structure - HPA004793 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human placenta and pancreas tissues using Anti-ARID3A antibody. Corresponding ARID3A RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human liver, placenta, testis and tonsil using Anti-ARID3A antibody HPA004793 (A) shows similar protein distribution across tissues to independent antibody HPA076330 (B).
Antibody #2 product nr: HPA076330
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human placenta shows strong nuclear positivity in trophoblastic cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human placenta shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis using Anti-ARID3A antibody HPA004793.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human tonsil using Anti-ARID3A antibody HPA004793.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver using Anti-ARID3A antibody HPA004793.
Sample type: HUMAN