Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00054751-M10 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00054751-M10, RRID:AB_530041
- Product name
- FBLIM1 monoclonal antibody (M10), clone 5E11
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant FBLIM1.
- Antigen sequence
VTCARCIGDESFALGSQNEVYCLDDFYRKFAPVCS
ICENPIIPRDGKDAFKIECMGRNFHENCYRCEDCR
ILLSVEPTDQGCYPLNNHLFCKPCHVKRSAAGCC- Isotype
- IgG
- Antibody clone number
- 5E11
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Kindlin-1 Is required for RhoGTPase-mediated lamellipodia formation in keratinocytes.
Has C, Herz C, Zimina E, Qu HY, He Y, Zhang ZG, Wen TT, Gache Y, Aumailley M, Bruckner-Tuderman L
The American journal of pathology 2009 Oct;175(4):1442-52
The American journal of pathology 2009 Oct;175(4):1442-52
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- FBLIM1 monoclonal antibody (M10), clone 5E11 Western Blot analysis of FBLIM1 expression in HepG2 ( Cat # L019V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of FBLIM1 expression in transfected 293T cell line by FBLIM1 monoclonal antibody (M10), clone 5E11.Lane 1: FBLIM1 transfected lysate(41 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged FBLIM1 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol