HPA004892

antibody from Atlas Antibodies

Targeting: CCNT1 CCNT, CYCT1, HIVE1

Antibody data

Submit

Validation data

Product number: HPA004892 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA004892, RRID:AB_1078607
Product name: Anti-CCNT1
Antibody type: Polyclonal
Reactivity: Human, Mouse, Rat
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: KTSEQTILNMISQSSSDTTIAGLMSMSTSTTSAVP SLPVSEESSSNLTSVEMLPGKRWLSSQPSFKLEPT QGHRTSENLALTGVDHSLPQDGSNAFISQKQNSKS VPSAKVSLKEYRAKHAEELAAQKRQLEN
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

CCNT1 protein structure - HPA004892 shown in red.

Enhanced validation

Submitted by: klas2
Enhanced method: Genetic validation
Main image
Experimental details: Western blot of cell lysate from U-2 OS cells transfected with either siRNA targeting CCNT1 or control siRNA. Lane 1: Marker (250, 130, 95, 72, 55, 36, 28, 17, 10) Lane 2: Cell lysate from U-2OS cells transfected with siRNA targeting CCNT1 Lane 3: N/A Lane 4: Cell lysate from U-2OS cells transfected with control siRNA Right image, lane 1-4: loading control
Sample type: U-2 OS
Primary Ab dilution: 1:131
Conjugate: Horseradish Peroxidase
Secondary Ab: Secondary Ab
Secondary Ab dilution: 1:3000
Knockdown/Genetic Approaches Application: Western blot
KD Reagent Type: siRNA
Downregulation: >75%
KD Reagent Prod page: KD Reagent Prod page
KD Reagent Prod no: s2539
KD Reagent Provider: Thermo Fisher Scientific
KD Reagent Prod no 2: s2541
KD Reagent Page 2: KD Reagent Page 2
KD Reagent Prod no 3: s2540
KD Reagent Page 3: KD Reagent Page 3
Antibody Lot Number: R04219
Appendix: 56601277aae6e.pdf

Supportive validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Genetic validation
Main image
Experimental details: Western blot analysis in HeLa cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-CCNT1 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 17Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.