Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [3]
Submit
Validation data
Reference
Comment
Report error
- Product number
- AMAb91254 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#AMAb91254, RRID:AB_2665866
- Product name
- Anti-FOXJ1
- Antibody type
- Monoclonal
- Reactivity
- Human
- Host
- Mouse
- Conjugate
- Unconjugated
- Antigen sequence
PREKDEPGKGGFWRIDPQYAERLLSGAFKKRRLPP
VHIHPAFARQAAQEPSAVPRAGPLTVNTEAQQLLR
EFEEATGEAGWGAGEGRLGHKRKQPLPKRVAKVPR
PPSTLLPTPEEQGELEPLKG- Epitope
- Binds to an epitope located within the peptide sequence EPGKGGFWRI as determined by overlapping synthetic peptides.
- Isotype
- IgG
- Antibody clone number
- CL3989
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining of BEWO cells using the Anti-FOXJ1 monoclonal antibody, showing specific staining in the nucleoplasm in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available).
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human fallopian tube shows strong nuclear immunoreactivity in glandular cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human endometrium shows strong nuclear positivity in some glandular cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human tonsil shows no positivity as expected (negative control).