HPA005714

antibody from Atlas Antibodies

Targeting: FOXJ1 FKHL13, HFH-4, HFH4

Antibody data

Submit

Validation data

Product number: HPA005714 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA005714, RRID:AB_1078902
Product name: Anti-FOXJ1
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: PREKDEPGKGGFWRIDPQYAERLLSGAFKKRRLPP VHIHPAFARQAAQEPSAVPRAGPLTVNTEAQQLLR EFEEATGEAGWGAGEGRLGHKRKQPLPKRVAKVPR PPSTLLPTPEEQGELEPLKG
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

FOXJ1 protein structure - HPA005714 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human fallopian tube and liver tissues using HPA005714 antibody. Corresponding FOXJ1 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human fallopian tube shows strong nuclear positivity in a subset of glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human endometrium shows strong nuclear positivity in a subset of glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows moderate nuclear positivity in a subset of cells in seminiferous ducts.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows no positivity as expected.
Sample type: HUMAN