SAB1401074

CHKB antibody from MilliporeSigma / Merck KGaA
CHETK, CHKL
Immunocytochemistry
Recommended by provider

Antibody data

Product number
SAB1401074
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#SAB1401074, RRID:AB_10609423
Product name
Anti-CHKB antibody produced in mouse
Provider product page
MilliporeSigma / Merck KGaA - SAB1401074
Antibody type
Polyclonal
Antigen
CHKB (NP_005189.2, 1 a.a. ~ 395 a.a) full-length human protein.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
MAAEATAVAGSGAVGGCLAKDGLQQSKCPDTTPKR
RRASSLSRDAERRAYQWCREYLGGAWRRVQPEELR
VYPVSGGLSNLLFRCSLPDHLPSVGEEPREVLLRL
YGAILQGVDSLVLESVMFAILAERSLGPQLYGVFP
EGRLEQYIPSRPLKTQELREPVLSAAIATKMAQFH
GMEMPFTKEPHWLFGTMERYLKQIQDLPPTGLPEM
NLLEMYSLKDEMGNLRKLLESTPSPVVFCHNDIQE
GNILLLSEPE
Storage
-20C
Provider Type Product Number
- No reagents -