Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA028516 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA028516, RRID:AB_10601751
- Product name
- Anti-LIMK1
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
EHSKLYCGHCYYQTVVTPVIEQILPDSPGSHLPHT
VTLVSIPASSHGKRGLSVSIDPPHGPPGCGTEHSH
TVRVQGVDPGCMSPDVKNSIHV- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Transcriptional profiling of GBM invasion genes identifies effective inhibitors of the LIM kinase-Cofilin pathway.
The interactome of LIM domain proteins: The contributions of LIM domain proteins to heart failure and heart development
Park JB, Agnihotri S, Golbourn B, Bertrand KC, Luck A, Sabha N, Smith CA, Byron S, Zadeh G, Croul S, Berens M, Rutka JT
Oncotarget 2014 Oct 15;5(19):9382-95
Oncotarget 2014 Oct 15;5(19):9382-95
The interactome of LIM domain proteins: The contributions of LIM domain proteins to heart failure and heart development
Li A, Ponten F, dos Remedios C
PROTEOMICS 2012 January;12(2):203-225
PROTEOMICS 2012 January;12(2):203-225
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear speckles & cytosol.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.
- Sample type
- HUMAN