Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- Immunocytochemistry [1]
- Immunohistochemistry [6]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA023739 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA023739, RRID:AB_1854308
- Product name
- Anti-NAPRT
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
LLDTYSVWRSGLPNFLAVALALGELGYRAVGVRLD
SGDLLQQAQEIRKVFRAAAAQFQVPWLESVLIVVS
NNIDEEALARLAQEGSEVNVIGIGTSV- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Mapping the Subcellular Protein Distribution in Three Human Cell Lines
Fagerberg L, Stadler C, Skogs M, Hjelmare M, Jonasson K, Wiking M, Åbergh A, Uhlén M, Lundberg E
Journal of Proteome Research 2011 August;10(8):3766-3777
Journal of Proteome Research 2011 August;10(8):3766-3777
No comments: Submit comment
Supportive validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Independent antibody validation
- Main image
- Experimental details
- Western blot analysis using Anti-NAPRT antibody HPA023739 (A) shows similar pattern to independent antibody HPA024017 (B).
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Western blot analysis in human liver tissue.
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm, cytosol & the Golgi apparatus.
- Sample type
- HUMAN
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Independent antibody validation
- Main image
- Experimental details
- Immunohistochemical staining of human colon, kidney, lymph node and urinary bladder using Anti-NAPRT antibody HPA023739 (A) shows similar protein distribution across tissues to independent antibody HPA024017 (B).
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows nuclear and cytoplasmic positivity in tubular cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney using Anti-NAPRT antibody HPA023739.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human urinary bladder using Anti-NAPRT antibody HPA023739.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human lymph node using Anti-NAPRT antibody HPA023739.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human colon using Anti-NAPRT antibody HPA023739.
- Sample type
- HUMAN