HPA021021

antibody from Atlas Antibodies

Targeting: CAVIN4 cavin-4, MURC

Antibody data

Submit

Validation data

Product number: HPA021021 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA021021, RRID:AB_1853082
Product name: Anti-MURC
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: KVSAHIKDVKARVEKQQIHVKKVEVKQEEIMKKNK FRVVIFQEKFRCPTSLSVVKDRNLTENQEEDDDDI FDPPVDLSSDEEYYVE
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

CAVIN4 protein structure - HPA021021 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human skeletal muscle and liver tissues using Anti-MURC antibody. Corresponding MURC RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, colon, pancreas and skeletal muscle using Anti-MURC antibody HPA021021 (A) shows similar protein distribution across tissues to independent antibody HPA020973 (B).
Antibody #2 product nr: HPA020973, HPA020987
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-MURC antibody HPA021021.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas using Anti-MURC antibody HPA021021.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-MURC antibody HPA021021.
Sample type: HUMAN