Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA019696 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA019696, RRID:AB_1852243
- Product name
- Anti-KRT76
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
LETKWELLQQQTTGSGPSSLEPCFESYISFLCKQL
DSLLGERGNLEGELKSMQDLVEDFK- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Keratin 76 is required for tight junction function and maintenance of the skin barrier.
Downregulation of keratin 76 expression during oral carcinogenesis of human, hamster and mouse.
DiTommaso T, Cottle DL, Pearson HB, Schlüter H, Kaur P, Humbert PO, Smyth IM
PLoS genetics 2014 Oct;10(10):e1004706
PLoS genetics 2014 Oct;10(10):e1004706
Downregulation of keratin 76 expression during oral carcinogenesis of human, hamster and mouse.
Ambatipudi S, Bhosale PG, Heath E, Pandey M, Kumar G, Kane S, Patil A, Maru GB, Desai RS, Watt FM, Mahimkar MB
PloS one 2013;8(7):e70688
PloS one 2013;8(7):e70688
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skin shows positivity in keratinized layer and basal cells of epidermis.
- Sample type
- HUMAN