HPA026874

antibody from Atlas Antibodies

Targeting: GANAB G2AN, GIIA, GluII, KIAA0088

Antibody data

Submit

Validation data

Product number: HPA026874 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA026874, RRID:AB_1849745
Product name: Anti-GANAB
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: AYQPFFRAHAHLDTGRREPWLLPSQHNDIIRDALG QRYSLLPFWYTLLYQAHREGIPVMRPLWVQYPQDV TTFNIDDQYLLGDALLVHPVSDSGAHGVQVYLPGQ GEVWYDIQSYQKHHGPQTLYLPVTLSSIPVFQ
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

GANAB protein structure - HPA026874 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human thyroid gland and skeletal muscle tissues using Anti-GANAB antibody. Corresponding GANAB RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, colon, skeletal muscle and thyroid gland using Anti-GANAB antibody HPA026874 (A) shows similar protein distribution across tissues to independent antibody HPA061426 (B).
Antibody #2 product nr: HPA061426
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human thyroid gland shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-GANAB antibody HPA026874.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-GANAB antibody HPA026874.
Sample type: HUMAN