WH0003714M3

JAG2 antibody from MilliporeSigma / Merck KGaA
ELISA
Recommended by provider

Antibody data

Product number
WH0003714M3
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#WH0003714M3, RRID:AB_1842161
Product name
Monoclonal Anti-JAG2 antibody produced in mouse
Provider product page
MilliporeSigma / Merck KGaA - WH0003714M3
Antibody type
Monoclonal
Antigen
JAG2 (NP_002217, a.a. 121-211) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
AGGDQDPGLVVIPFQFAWPRSFTLIVEAWDWDNDT
TPNEELLIERVSHAGMINPEDRWKSLHFSGHVAHL
ELQIRVRCDENYYSAPCNKF* (without GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -