Antibody data

Product number
H00003714-M03
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00003714-M03, RRID:AB_733203
Product name
JAG2 monoclonal antibody (M03), clone 4F10
Provider product page
Abnova Corporation - H00003714-M03
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant JAG2.
Antigen sequence
AGGDQDPGLVVIPFQFAWPRSFTLIVEAWDWDNDT
TPNEELLIERVSHAGMINPEDRWKSLHFSGHVAHL
ELQIRVRCDENYYSAPCNKF
Isotype
IgG
Antibody clone number
4F10
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -