HPA049055

antibody from Atlas Antibodies

Targeting: SLC5A5 NIS

Antibody data

Submit

Validation data

Product number: HPA049055 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA049055, RRID:AB_2680614
Product name: Anti-SLC5A5
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: PTKRSTLAPGLLWWDLARQTASVAPKEEVAILDDN LVKGPEELPTGNKKPPGFLPTNEDRLFFLGQKELE GAGSWTPCVGHDGGRDQQETNL
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

SLC5A5 protein structure - HPA049055 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human salivary gland and placenta tissues using HPA049055 antibody. Corresponding SLC5A5 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human salivary gland shows membranous positivity in ductal cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human stomach shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human stomach shows strong membranous positivity in glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human placenta shows no positivity in trophoblastic cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human salivary gland shows strong membranous positivity in glandular cells.
Sample type: HUMAN