HPA036565

MATR3 antibody from Atlas Antibodies
KIAA0723, MGC9105, MPD2, VCPDM

Antibody data

Product number
HPA036565
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA036565, RRID:AB_10673623
Product name
Anti-MATR3
Provider product page
Atlas Antibodies - HPA036565
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LKRRRTEEGPTLSYGRDGRSATREPPYRVPRDDWE
EKRHFRRDSFDDRGPSLNPVLDYDHGSRSQESGYY
DRMDYEDDRLRDGERCRDD
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.