Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Immunohistochemistry [4]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA008455 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA008455, RRID:AB_1079334
- Product name
- Anti-MCL1
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
DAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESG
NNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYL
REQATGAKDTKPMGRSGATSRKALETLRRVGDG- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Global variability in gene expression and alternative splicing is modulated by mitochondrial content
Targeting Bcl-2/Bcl-XL induces antitumor activity in uveal melanoma patient-derived xenografts.
The synergism of MCL1 and glycolysis on pediatric acute lymphoblastic leukemia cell survival and prednisolone resistance.
Guantes R, Rastrojo A, Neves R, Lima A, Aguado B, Iborra F
Genome Research 2015 May;25(5):633-644
Genome Research 2015 May;25(5):633-644
Targeting Bcl-2/Bcl-XL induces antitumor activity in uveal melanoma patient-derived xenografts.
Némati F, de Montrion C, Lang G, Kraus-Berthier L, Carita G, Sastre-Garau X, Berniard A, Vallerand D, Geneste O, de Plater L, Pierré A, Lockhart B, Desjardins L, Piperno-Neumann S, Depil S, Decaudin D
PloS one 2014;9(1):e80836
PloS one 2014;9(1):e80836
The synergism of MCL1 and glycolysis on pediatric acute lymphoblastic leukemia cell survival and prednisolone resistance.
Ariës IM, Hansen BR, Koch T, van den Dungen R, Evans WE, Pieters R, den Boer ML
Haematologica 2013 Dec;98(12):1905-11
Haematologica 2013 Dec;98(12):1905-11
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human lymph node shows strong cytoplasmic positivity in reaction center cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human colon shows moderate cytoplasmic positivity in glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human lymph node shows moderate cytoplasmic positivity in germinal center cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human placenta shows weak cytoplasmic positivity in trophoblastic cells.
- Sample type
- HUMAN