Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunohistochemistry [5]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA007179 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA007179, RRID:AB_1079714
- Product name
- Anti-PTPRN
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
HSYGDLPGPSPAQLFQDSGLLYLAQELPAPSRARV
PRLPEQGSSSRAEDSPEGYEKEGLGDRGEKPASPA
VQPDAALQRLAAVLAGYGVELRQLTPEQLSTLLTL
LQLLPKGA- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Novel pancreatic beta cell-specific proteins: Antibody-based proteomics for identification of new biomarker candidates
Lindskog C, Korsgren O, Pontén F, Eriksson J, Johansson L, Danielsson A
Journal of Proteomics 2012 May;75(9):2611-2620
Journal of Proteomics 2012 May;75(9):2611-2620
No comments: Submit comment
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human adrenal gland and skeletal muscle tissues using Anti-PTPRN antibody. Corresponding PTPRN RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of adrenal gland shows strong cytoplasmic positivity in medullary cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human adrenal gland shows high expression.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human adrenal gland shows strong cytoplasmic positivity in medullary cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skeletal muscle shows low expression as expected.
- Sample type
- HUMAN