HPA019587

antibody from Atlas Antibodies

Targeting: UPF1 HUPF1, KIAA0221, NORF1, pNORF1, RENT1, smg-2

Antibody data

Submit

Validation data

Product number: HPA019587 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA019587, RRID:AB_1856174
Product name: Anti-UPF1
Antibody type: Polyclonal
Reactivity: Human, Mouse, Rat
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: LEELWKENPSATLEDLEKPGVDEEPQHVLLRYEDA YQYQNIFGPLVKLEADYDKKLKESQTQDNITVRWD LGLNKKRIAYFTLPKTD
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

UPF1 protein structure - HPA019587 shown in red.

Enhanced validation

Submitted by: klas2
Enhanced method: Genetic validation
Main image
Experimental details: Western blot of cell lysate from U-2 OS cells transfected with either siRNA targeting UPF1 or control siRNA. Lane 1: Marker (250, 130, 95, 72, 55, 36, 28, 17, 10) Lane 2: Cell lysate from U-2OS cells transfected with siRNA targeting UPF1 Lane 3: N/A Lane 4: Cell lysate from U-2OS cells transfected with control siRNA Right image, lane 1-4: loading control
Sample type: U-2 OS
Primary Ab dilution: 1:114
Conjugate: Horseradish Peroxidase
Secondary Ab: Secondary Ab
Secondary Ab dilution: 1:3000
Knockdown/Genetic Approaches Application: Western blot
KD Reagent Type: siRNA
Downregulation: >75%
KD Reagent Prod page: KD Reagent Prod page
KD Reagent Prod no: s11927
KD Reagent Provider: Thermo Fisher Scientific
KD Reagent Page 2: KD Reagent Page 2
KD Reagent Prod no 2: s11928
KD Reagent Page 3: KD Reagent Page 3
KD Reagent Prod no 3: s11926
Antibody Lot Number: R08551
Appendix: 566bf6342552e.pdf

Supportive validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Genetic validation
Main image
Experimental details: Western blot analysis in A-549 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-UPF1 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Genetic validation
Main image
Experimental details: Western blot analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-UPF1 antibody. Remaining relative intensity is presented

Supportive validation

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.