Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [4]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA021638 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA021638, RRID:AB_10960885
- Product name
- Anti-RCOR2
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
PSVMEKPSAGSGILSRSRAKTVPNGGQPHSEDDSS
EEEHSHDSMIRVGTNYQAVIPECKPESPARYSNKE
LKGMLVWSPNHCVSDAK- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Decreased Expression of CoREST1 and CoREST2 Together with LSD1 and HDAC1/2 during Neuronal Differentiation.
Differential properties of transcriptional complexes formed by the CoREST family.
Sáez JE, Gómez AV, Barrios ÁP, Parada GE, Galdames L, González M, Andrés ME
PloS one 2015;10(6):e0131760
PloS one 2015;10(6):e0131760
Differential properties of transcriptional complexes formed by the CoREST family.
Barrios ÁP, Gómez AV, Sáez JE, Ciossani G, Toffolo E, Battaglioli E, Mattevi A, Andrés ME
Molecular and cellular biology 2014 Jul;34(14):2760-70
Molecular and cellular biology 2014 Jul;34(14):2760-70
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line Hep G2 shows localization to nucleus.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows moderate cytoplasmic and nuclear positivity in neuronal cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows weak to moderate nuclear and cytoplasmic positivity in neurons.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows moderate to strong nuclear positivity in a subset of cells in seminiferous ducts.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human placenta shows moderate nuclear and cytoplasmic positivity in trophoblastic cells.
- Sample type
- HUMAN