Antibody data
- Antibody Data
- Antigen structure
- References [9]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010551-M03 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010551-M03, RRID:AB_565473
- Product name
- AGR2 monoclonal antibody (M03), clone 1C3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant AGR2.
- Antigen sequence
MEKIPVSAFLLLVALSYTLARDTTVKPGAKKDTKD
SRPKLPQTLSRGWGDQLIWTQTYEEALYKSKTSNK
PLMIIHHLDECPHSQALKKVFAENKEIQKLAEQFV
LLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRAD
ITGRYSNRLYAYEPADTALLLDNMKKALKLLKTEL- Isotype
- IgG
- Antibody clone number
- 1C3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Epidermal growth factor receptor (EGFR) signaling requires a specific endoplasmic reticulum thioredoxin for the post-translational control of receptor presentation to the cell surface.
Loss of anterior gradient-2 expression is an independent prognostic factor in colorectal carcinomas.
Development of a fluorescent monoclonal antibody-based assay to measure the allosteric effects of synthetic peptides on self-oligomerization of AGR2 protein.
Development of an ELISA to detect the secreted prostate cancer biomarker AGR2 in voided urine.
Anterior gradient protein 2 (AGR2) is an independent prognostic factor in ovarian high-grade serous carcinoma.
Differential expression of the anterior gradient protein-2 is a conserved feature during morphogenesis and carcinogenesis of the biliary tree.
2,3,7,8-tetrachlorodibenzo-p-dioxin counteracts the p53 response to a genotoxicant by upregulating expression of the metastasis marker agr2 in the hepatocarcinoma cell line HepG2.
A divergent substrate-binding loop within the pro-oncogenic protein anterior gradient-2 forms a docking site for Reptin.
Identification of candidate biomarkers of therapeutic response to docetaxel by proteomic profiling.
Dong A, Wodziak D, Lowe AW
The Journal of biological chemistry 2015 Mar 27;290(13):8016-27
The Journal of biological chemistry 2015 Mar 27;290(13):8016-27
Loss of anterior gradient-2 expression is an independent prognostic factor in colorectal carcinomas.
Riener MO, Thiesler T, Hellerbrand C, Amann T, Cathomas G, Fritzsche FR, Dahl E, Bahra M, Weichert W, Terracciano L, Kristiansen G
European journal of cancer (Oxford, England : 1990) 2014 Jul;50(10):1722-30
European journal of cancer (Oxford, England : 1990) 2014 Jul;50(10):1722-30
Development of a fluorescent monoclonal antibody-based assay to measure the allosteric effects of synthetic peptides on self-oligomerization of AGR2 protein.
Gray TA, Murray E, Nowicki MW, Remnant L, Scherl A, Muller P, Vojtesek B, Hupp TR
Protein science : a publication of the Protein Society 2013 Sep;22(9):1266-78
Protein science : a publication of the Protein Society 2013 Sep;22(9):1266-78
Development of an ELISA to detect the secreted prostate cancer biomarker AGR2 in voided urine.
Wayner EA, Quek SI, Ahmad R, Ho ME, Loprieno MA, Zhou Y, Ellis WJ, True LD, Liu AY
The Prostate 2012 Jun 15;72(9):1023-34
The Prostate 2012 Jun 15;72(9):1023-34
Anterior gradient protein 2 (AGR2) is an independent prognostic factor in ovarian high-grade serous carcinoma.
Darb-Esfahani S, Fritzsche F, Kristiansen G, Weichert W, Sehouli J, Braicu I, Dietel M, Denkert C
Virchows Archiv : an international journal of pathology 2012 Aug;461(2):109-16
Virchows Archiv : an international journal of pathology 2012 Aug;461(2):109-16
Differential expression of the anterior gradient protein-2 is a conserved feature during morphogenesis and carcinogenesis of the biliary tree.
Lepreux S, Bioulac-Sage P, Chevet E
Liver international : official journal of the International Association for the Study of the Liver 2011 Mar;31(3):322-8
Liver international : official journal of the International Association for the Study of the Liver 2011 Mar;31(3):322-8
2,3,7,8-tetrachlorodibenzo-p-dioxin counteracts the p53 response to a genotoxicant by upregulating expression of the metastasis marker agr2 in the hepatocarcinoma cell line HepG2.
Ambolet-Camoit A, Bui LC, Pierre S, Chevallier A, Marchand A, Coumoul X, Garlatti M, Andreau K, Barouki R, Aggerbeck M
Toxicological sciences : an official journal of the Society of Toxicology 2010 Jun;115(2):501-12
Toxicological sciences : an official journal of the Society of Toxicology 2010 Jun;115(2):501-12
A divergent substrate-binding loop within the pro-oncogenic protein anterior gradient-2 forms a docking site for Reptin.
Maslon MM, Hrstka R, Vojtesek B, Hupp TR
Journal of molecular biology 2010 Dec 3;404(3):418-38
Journal of molecular biology 2010 Dec 3;404(3):418-38
Identification of candidate biomarkers of therapeutic response to docetaxel by proteomic profiling.
Zhao L, Lee BY, Brown DA, Molloy MP, Marx GM, Pavlakis N, Boyer MJ, Stockler MR, Kaplan W, Breit SN, Sutherland RL, Henshall SM, Horvath LG
Cancer research 2009 Oct 1;69(19):7696-703
Cancer research 2009 Oct 1;69(19):7696-703
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- AGR2 monoclonal antibody (M03), clone 1C3 Western Blot analysis of AGR2 expression in MCF-7 ( Cat # L046V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of AGR2 expression in transfected 293T cell line by AGR2 monoclonal antibody (M03), clone 1C3.Lane 1: AGR2 transfected lysate(20 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged AGR2 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol