Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006895-M03 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006895-M03, RRID:AB_1112164
- Product name
- TARBP2 monoclonal antibody (M03), clone 1D9
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant TARBP2.
- Antigen sequence
RSPPMELQPPVSPQQSECNPVGALQELVVQKGWRL
PEYTVTQESGPAHRKEFTMTCRVERFIEIGSGTSK
KLAKRNAAAKMLLRVHTVPLDARDGNEVEPDDDHF
SIGVG- Isotype
- IgG
- Antibody clone number
- 1D9
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of TARBP2 expression in transfected 293T cell line by TARBP2 monoclonal antibody (M03), clone 1D9.Lane 1: TARBP2 transfected lysate (Predicted MW: 39 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged TARBP2 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoprecipitation of TARBP2 transfected lysate using anti-TARBP2 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with TARBP2 purified MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol
