ABIN1107209
antibody from antibodies-online
Targeting: FEZF2
FEZL, FKSG36, FLJ10142, TOF, Zfp312, ZNF312
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1107209 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-FEZ Family Zinc Finger 2 (FEZF2) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ZNF312 antibody: synthetic peptide directed towards the N terminal of human ZNF312.
- Description
- Purified using Protein A affinity column
- Reactivity
- Human, Mouse, Rat, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
MASSASLETMVPPACPRAGASPATSKTLAFSIERI
MAKTSEPRAPFEPRP- Epitope
- N-Term
- Vial size
- 0.1 mg
- Storage
- Store lyophilized at 2-8°C or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or in aliquots at -20°C long term.
- Handling
- Avoid repeated freezing and thawing.
Submitted references Expression of the zinc finger gene fez-like in zebrafish forebrain.
Hashimoto H, Yabe T, Hirata T, Shimizu T, Bae Y, Yamanaka Y, Hirano T, Hibi M
Mechanisms of development 2000 Oct;97(1-2):191-5
Mechanisms of development 2000 Oct;97(1-2):191-5
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Human Jurkat; WB Suggested Anti-ZNF312 Antibody Titration: 2.5ug/ml. Positive Control: Jurkat cell lysate; ZNF312 antibody - N-terminal region (AP42180PU-N) in Human Jurkat cells using Western Blot