ABIN1107209

FEZF2 antibody from antibodies-online
FEZL, FKSG36, FLJ10142, TOF, Zfp312, ZNF312

Antibody data

Product number
ABIN1107209
Provider
antibodies-online
Product name
anti-FEZ Family Zinc Finger 2 (FEZF2) (N-Term) antibody
Provider product page
antibodies-online - ABIN1107209
Antibody type
Polyclonal
Antigen
The immunogen for anti-ZNF312 antibody: synthetic peptide directed towards the N terminal of human ZNF312.
Description
Purified using Protein A affinity column
Reactivity
Human, Mouse, Rat, Bovine, Canine
Host
Rabbit
Antigen sequence
MASSASLETMVPPACPRAGASPATSKTLAFSIERI
MAKTSEPRAPFEPRP
Epitope
N-Term
Vial size
0.1 mg
Storage
Store lyophilized at 2-8°C or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or in aliquots at -20°C long term.
Handling
Avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -