ABIN182747

FEZF2 antibody from antibodies-online
FEZL, FKSG36, FLJ10142, TOF, Zfp312, ZNF312

Antibody data

Product number
ABIN182747
Provider
antibodies-online
Product name
anti-FEZ Family Zinc Finger 2 (FEZF2) (N-Term) antibody
Provider product page
antibodies-online - ABIN182747
Antibody type
Polyclonal
Antigen
The immunogen for anti-ZNF312 antibody: synthetic peptide directed towards the N terminal of human ZNF312
Description
Protein A purified
Reactivity
Human, Mouse, Rat, Bovine, Canine
Host
Rabbit
Antigen sequence
MASSASLETMVPPACPRAGASPATSKTLAFSIERI
MAKTS EPRAPFEPRP
Epitope
N-Term
Vial size
100 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -