AV39321

FEZF2 antibody from MilliporeSigma / Merck KGaA
FEZL, FKSG36, FLJ10142, TOF, Zfp312, ZNF312
No application information provided.

Antibody data

Product number
AV39321
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#AV39321, RRID:AB_1859183
Product name
Anti-ZNF312 (AB2) antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - AV39321
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human ZNF312 with an internal ID of P21333
Description
IgG fraction of antiserum
Reactivity
Human
Antigen sequence
KAFHQVYNLTFHMHTHNDKKPFTCATCGKGFCRNF
DLKKHVRKLHDSVGP
Storage
-20C
Provider Type Product Number
- No reagents -