Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [7]
- Comments [0]
- Validations
- Western blot [2]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000684-B02P - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000684-B02P, RRID:AB_1204015
- Product name
- BST2 purified MaxPab mouse polyclonal antibody (B02P)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a full-length human BST2 protein.
- Antigen sequence
MASTSYDYCRVPMEDGDKRCKLLLGIGILVLLIIV
ILGVPLIIFTIKANSEACRDGLRAVMECRNVTHLL
QQELTEAQKGFQDVEAQAATCNHTVMALMASLDAE
KAQGQKKVEELEGEITTLNHKLQDASAEVERLRRE
NQVLSVRIADKKYYPSSQDSSSAAAPQLLIVLLGL
SALLQ- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Lack of adaptation to human tetherin in HIV-1 group O and P.
Tethered virions are intermediates in the assembly and release of HIV-1 particles.
HIV-1 Vpu and HIV-2 Env counteract BST-2/tetherin by sequestration in a perinuclear compartment.
Tetherin restricts productive HIV-1 cell-to-cell transmission.
Ebola virus glycoprotein counteracts BST-2/Tetherin restriction in a sequence-independent manner that does not require tetherin surface removal.
Simian immunodeficiency virus envelope glycoprotein counteracts tetherin/BST-2/CD317 by intracellular sequestration.
HIV-1 accessory protein Vpu internalizes cell-surface BST-2/tetherin through transmembrane interactions leading to lysosomes.
Yang SJ, Lopez LA, Exline CM, Haworth KG, Cannon PM
Retrovirology 2011 Sep 28;8:78
Retrovirology 2011 Sep 28;8:78
Tethered virions are intermediates in the assembly and release of HIV-1 particles.
Karetnikov A, Suomalainen M
Virology 2010 Nov 25;407(2):289-95
Virology 2010 Nov 25;407(2):289-95
HIV-1 Vpu and HIV-2 Env counteract BST-2/tetherin by sequestration in a perinuclear compartment.
Hauser H, Lopez LA, Yang SJ, Oldenburg JE, Exline CM, Guatelli JC, Cannon PM
Retrovirology 2010 Jun 7;7:51
Retrovirology 2010 Jun 7;7:51
Tetherin restricts productive HIV-1 cell-to-cell transmission.
Casartelli N, Sourisseau M, Feldmann J, Guivel-Benhassine F, Mallet A, Marcelin AG, Guatelli J, Schwartz O
PLoS pathogens 2010 Jun 17;6(6):e1000955
PLoS pathogens 2010 Jun 17;6(6):e1000955
Ebola virus glycoprotein counteracts BST-2/Tetherin restriction in a sequence-independent manner that does not require tetherin surface removal.
Lopez LA, Yang SJ, Hauser H, Exline CM, Haworth KG, Oldenburg J, Cannon PM
Journal of virology 2010 Jul;84(14):7243-55
Journal of virology 2010 Jul;84(14):7243-55
Simian immunodeficiency virus envelope glycoprotein counteracts tetherin/BST-2/CD317 by intracellular sequestration.
Gupta RK, Mlcochova P, Pelchen-Matthews A, Petit SJ, Mattiuzzo G, Pillay D, Takeuchi Y, Marsh M, Towers GJ
Proceedings of the National Academy of Sciences of the United States of America 2009 Dec 8;106(49):20889-94
Proceedings of the National Academy of Sciences of the United States of America 2009 Dec 8;106(49):20889-94
HIV-1 accessory protein Vpu internalizes cell-surface BST-2/tetherin through transmembrane interactions leading to lysosomes.
Iwabu Y, Fujita H, Kinomoto M, Kaneko K, Ishizaka Y, Tanaka Y, Sata T, Tokunaga K
The Journal of biological chemistry 2009 Dec 11;284(50):35060-72
The Journal of biological chemistry 2009 Dec 11;284(50):35060-72
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- BST2 MaxPab polyclonal antibody. Western Blot analysis of BST2 expression in Jurkat.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of BST2 expression in transfected 293T cell line (H00000684-T02) by BST2 MaxPab polyclonal antibody.Lane 1: BST2 transfected lysate(19.8 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of purified MaxPab antibody to BST2 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of purified MaxPab antibody to BST2 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol
