Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1109584 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Zinc Finger Protein 385A (ZNF385A) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ZNF385 antibody: synthetic peptide directed towards the N terminal of human ZNF385
- Description
- Purified using peptide immunoaffinity column
- Reactivity
- Human, Mouse, Rat, Bovine
- Host
- Rabbit
- Antigen sequence
EPAPTLGLFSNYSTMDPVQKAVLSHTFGGPLLKTK
RPVISCNICQIRFNS- Epitope
- N-Term
- Vial size
- 50 μg
- Storage
- Store lyophilized at 2-8°C or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or in aliquots at -20°C long term.
- Handling
- Avoid repeated freezing and thawing.
Submitted references RZF, a zinc-finger protein in the photoreceptors of human retina.
Sharma S, Dimasi D, Higginson K, Della NG
Gene 2004 Nov 24;342(2):219-29
Gene 2004 Nov 24;342(2):219-29
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Human brain; WB Suggested Anti-ZNF385 Antibody Titration: 0.2-1 ug/ml. Positive Control: Human brain; ZNF385 antibody - N-terminal region (AP42120PU-N) in Human brain cells using Western Blot
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Human Lung; ZNF385 antibody - N-terminal region (AP42120PU-N) in Human Lung cells using Immunohistochemistry
