Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA019616 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA019616, RRID:AB_1847988
- Product name
- Anti-LPAR2
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
LLLDGLGCESCNVLAVEKYFLLLAEANSLVNAAVY
SCRDAEMRRTFRRLLCCACLRQSTRESVHYTSSAQ
GGASTRIMLPENGHPLMDSTL- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references LPA Induces Colon Cancer Cell Proliferation through a Cooperation between the ROCK and STAT-3 Pathways
In vivo collective cell migration requires an LPAR2-dependent increase in tissue fluidity.
Leve F, Peres-Moreira R, Binato R, Abdelhay E, Morgado-Díaz J, Anant S
PLOS ONE 2015 September;10(9)
PLOS ONE 2015 September;10(9)
In vivo collective cell migration requires an LPAR2-dependent increase in tissue fluidity.
Kuriyama S, Theveneau E, Benedetto A, Parsons M, Tanaka M, Charras G, Kabla A, Mayor R
The Journal of cell biology 2014 Jul 7;206(1):113-27
The Journal of cell biology 2014 Jul 7;206(1):113-27
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human prostate shows strong cytoplasmic and membranous positivity in glandular cells.
- Sample type
- HUMAN