H00006354-A01

CCL7 antibody from Abnova Corporation
FIC, MARC, MCP-3, MCP3, NC28, SCYA6, SCYA7
No application information provided.

Antibody data

Product number
H00006354-A01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00006354-A01, RRID:AB_462473
Product name
CCL7 polyclonal antibody (A01)
Provider product page
Abnova Corporation - H00006354-A01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a partial recombinant CCL7.
Antigen sequence
QPVGINTSTTCCYRFINKKIPKQRLESYRRTTSSH
CPREAVIFKTKLDKEICADPTQKWVQDFMKHLDKK
TQTPKL
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -