H00006354-M03

CCL7 antibody from Abnova Corporation
FIC, MARC, MCP-3, MCP3, NC28, SCYA6, SCYA7

Antibody data

Product number
H00006354-M03
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00006354-M03, RRID:AB_622281
Product name
CCL7 monoclonal antibody (M03), clone 4B5
Provider product page
Abnova Corporation - H00006354-M03
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant CCL7.
Antigen sequence
QPVGINTSTTCCYRFINKKIPKQRLESYRRTTSSH
CPREAVIFKTKLDKEICADPTQKWVQDFMKHLDKK
TQTPKL
Isotype
IgG
Antibody clone number
4B5
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -