Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000307-M13 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000307-M13, RRID:AB_1136887
- Product name
- ANXA4 monoclonal antibody (M13), clone 1D3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full-length recombinant ANXA4.
- Antigen sequence
MAMATKGGTVKAASGFNAMEDAQTLRKAMKGLGTD
EDAIISVLAYRNTAQRQEIRTAYKSTIGRDLIDDL
KSELSGNFEQVIVGMMTPTVLYDVQELRRAMKGAG
TDEGCLIEILASRTPEEIRRISQTYQQQYGRSLED
DIRSDTSFMFQRVLVSLSAGGRDEGNYLDDALVRQ
DAQDLYEAGEKKWGTDEVKFLTVLCSRNRNHLLHV
FDEYKRISQKDIEQSIKSETSGSFEDALLAIVKCM
RNKSAYFAEKLYKSMKGLGTDDNTLIRVMVSRAEI
DMLDIRAHFKRLYGKSLYSFIKGDTSGDYRKVLLV
LCGGDD- Isotype
- IgG
- Antibody clone number
- 1D3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Proteomic analysis of the sheep caruncular and intercaruncular endometrium reveals changes in functional proteins crucial for the establishment of pregnancy.
Annexin A4 is a possible biomarker for cisplatin susceptibility of malignant mesothelioma cells.
Al-Gubory KH, Arianmanesh M, Garrel C, Bhattacharya S, Cash P, Fowler PA
Reproduction (Cambridge, England) 2014 May;147(5):599-614
Reproduction (Cambridge, England) 2014 May;147(5):599-614
Annexin A4 is a possible biomarker for cisplatin susceptibility of malignant mesothelioma cells.
Yamashita T, Nagano K, Kanasaki S, Maeda Y, Furuya T, Inoue M, Nabeshi H, Yoshikawa T, Yoshioka Y, Itoh N, Abe Y, Kamada H, Tsutsumi Y, Tsunoda S
Biochemical and biophysical research communications 2012 Apr 27;421(1):140-4
Biochemical and biophysical research communications 2012 Apr 27;421(1):140-4
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of ANXA4 expression in transfected 293T cell line by ANXA4 monoclonal antibody (M13), clone 1D3.Lane 1: ANXA4 transfected lysate(36.1 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to ANXA4 on formalin-fixed paraffin-embedded human endometrium. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol