AMAb90703

antibody from Atlas Antibodies

Targeting: FLT1 FLT, VEGFR1

Antibody data

Submit

Validation data

Product number: AMAb90703 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#AMAb90703, RRID:AB_2665636
Product name: Anti-FLT1
Antibody type: Monoclonal
Reactivity: Human
Host: Mouse
Conjugate: Unconjugated
Antigen sequence: LNLTIMNVSLQDSGTYACRARNVYTGEEILQKKEI TIRDQEAPYLLRNLSDHTVAISSSTTLDCHANGVP EPQITWFKNNHKIQQEPGIILGPGSSTLFIERVTE EDEGVYHCKATNQKGS
Epitope: Binds to an epitope located within the peptide sequence EPQITWFKNN as determined by overlapping synthetic peptides.
Isotype: IgG
Antibody clone number: CL0344
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

FLT1 protein structure - AMAb90703 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human placenta and tonsil tissues using AMAb90703 antibody. Corresponding FLT1 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows moderate immunoreactivity in the endothelial cells of the blood vessel.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human stomach cancer shows positivity in blood vessels.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human small intestine shows immunoreactivity in the endothelial cells of the blood vessels.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in endothelial cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human small intestine shows strong cytoplasmic positivity in endothelial cells, as well as positivity in smooth muscle.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human tonsil shows no cytoplasmic positivity in lymphoid cells as expected.