HPA041646

antibody from Atlas Antibodies

Targeting: POU1F1 GHF-1, PIT-1, PIT1, POU1F1a

Antibody data

Submit

Validation data

Product number: HPA041646 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA041646, RRID:AB_10794672
Product name: Anti-POU1F1
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: CKLKAILSKWLEEAEQVGALYNEKVGANERKRKRR TTISIAAKDALERHFGEQNKPSSQEIMRMAE
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

POU1F1 protein structure - HPA041646 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human liver, pancreas, pituitary gland and tonsil using Anti-POU1F1 antibody HPA041646 (A) shows similar protein distribution across tissues to independent antibody HPA050624 (B).
Antibody #2 product nr: HPA050624
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pituitary gland shows strong nuclear positivity in cells in anterior lobe.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human tonsil shows no positivity in non-germinal center cells as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pituitary gland shows moderate to strong nuclear positivity in neuroendocrine cells in the anterior lobe.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected.
Sample type: HUMAN