Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA042399 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA042399, RRID:AB_2677978
- Product name
- Anti-IL22RA1
- Antibody type
- Polyclonal
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
VETGNLTELYYARVTAVSAGGRSATKMTDRFSSLQ
HTTLKPPDVTCISKVRSIQMIVHPTPTPIRAGDGH
RLTLEDIFHDLFYHLELQVNRTYQMHLGGKQREYE
FFGLTPDTEFLGTIMICVPTW- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Low Interleukin-22 Binding Protein Is Associated With High Mortality in Alcoholic Hepatitis and Modulates Interleukin-22 Receptor Expression
Histopathological Features of the Development of Intestine and Mesenteric Lymph Node Injury in a Nonhuman Primate Model of Partial-body Irradiation with Minimal Bone Marrow Sparing
Støy S, Laursen T, Glavind E, Eriksen P, Terczynska-Dyla E, Magnusson N, Hamilton-Dutoit S, Mortensen F, Veidal S, Rigbolt K, Riggio O, Deleuran B, Vilstrup H, Sandahl T
Clinical and Translational Gastroenterology 2020;11(8):e00197
Clinical and Translational Gastroenterology 2020;11(8):e00197
Histopathological Features of the Development of Intestine and Mesenteric Lymph Node Injury in a Nonhuman Primate Model of Partial-body Irradiation with Minimal Bone Marrow Sparing
Parker G, Li N, Takayama K, Booth C, Tudor G, Farese A, MacVittie T
Health Physics 2019;116(3):426-446
Health Physics 2019;116(3):426-446
No comments: Submit comment
No validations: Submit validation data