Explore
Validate
Learn
Western blot
ImmunocytochemistryAntibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [7]
Submit
Validation data
Reference
Comment
Report error
- Product number
- AMAb90663 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#AMAb90663, RRID:AB_2665624
- Product name
- Anti-CTCF
- Antibody type
- Monoclonal
- Reactivity
- Human
- Host
- Mouse
- Conjugate
- Unconjugated
- Antigen sequence
QNQTDGGEVVQDVNSSVQMVMMEQLDPTLLQMKTE
VMEGTVAPEAEAAVDDTQIITLQVVNMEEQPINIG
ELQLVQVPVPVTVPVATTSVEELQGAYENEVSKEG
LAESEPMICHTLPLPEGFQVVKVGANGEVETLEQG
ELPPQEDP- Epitope
- Binds to an epitope located within the peptide sequence AYENEVSKEG as determined by overlapping synthetic peptides.
- Isotype
- IgG
- Antibody clone number
- CL0304
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Antibodies Biotinylated Using a Synthetic Z-domain from Protein A Provide Stringent In Situ Protein Detection
Antibodies biotinylated using a synthetic Z-domain from protein A provide stringent in situ protein detection.
Andersson S, Konrad A, Ashok N, Ponten F, Hober S, Asplund A
Journal of Histochemistry & Cytochemistry 2013 October;61(11):773-784
Journal of Histochemistry & Cytochemistry 2013 October;61(11):773-784
Antibodies biotinylated using a synthetic Z-domain from protein A provide stringent in situ protein detection.
Andersson S, Konrad A, Ashok N, Pontén F, Hober S, Asplund A
The journal of histochemistry and cytochemistry : official journal of the Histochemistry Society 2013 Nov;61(11):773-84
The journal of histochemistry and cytochemistry : official journal of the Histochemistry Society 2013 Nov;61(11):773-84
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining of MCF7 cells using the Anti-CTCF monoclonal antibody, showing specific staining in the nucleoplasm in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available).
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human stomach shows nuclear positivity in glandular cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows nuclear positivity in both renal tubuli and glomeruli.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human uterus shows nuclear positivity in glandular and stromal cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human endometrium shows moderate to strong nuclear positivity in glandular and stromal cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows moderate to strong nuclear positivity in cells in tubules and glomeruli.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human small intestine shows moderate nuclear positivity in glandular cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows moderate nuclear positivity in a subset of cells in seminiferous ducts.
