AV04007

TOP2A antibody from Sigma-Aldrich
TOP2
No application information provided.

Antibody data

Product number
AV04007
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#AV04007, RRID:AB_1858188
Product name
Anti-TOP2A antibody produced in rabbit
Provider product page
Sigma-Aldrich - AV04007
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human TOP2A with an internal ID of P01048
Description
IgG fraction of antiserum
Reactivity
Human
Antigen sequence
VSKAVTSKKSKGESDDFHMDFDSAVAPRAKSVRAK
KPIKYLEESDEDDLF
Storage
-20C
Provider Type Product Number
- No reagents -