HPA011731

antibody from Atlas Antibodies

Targeting: SELENBP1 hSBP, hSP56, LPSB

Antibody data

Submit

Validation data

Product number: HPA011731 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA011731, RRID:AB_1856663
Product name: Anti-SELENBP1
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: TWSVEKVIQVPPKKVKGWLLPEMPGLITDILLSLD DRFLYFSNWLHGDLRQYDISDPQRPRLTGQLFLGG SIVKGGPVQVLEDEELKSQPEPLVVKGKRVAGGPQ MIQLSLDGKRLYITTSLYSAWDKQFYPDLI
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

SELENBP1 protein structure - HPA011731 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human colon and tonsil tissues using HPA011731 antibody. Corresponding SELENBP1 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human colon, fallopian tube, liver and tonsil using Anti-SELENBP1 antibody HPA011731 (A) shows similar protein distribution across tissues to independent antibody HPA005741 (B).
Antibody #2 product nr: HPA005741
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-SELENBP1 antibody HPA011731.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human fallopian tube using Anti-SELENBP1 antibody HPA011731.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human tonsil shows no positivity in non-germinal center cells as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon shows strong cytoplasmic positivity in glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human Fallopian tube shows weak to moderate nuclear positivity in glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows strong cytoplasmic and nuclear positivity in hepatocytes.
Sample type: HUMAN