Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010165-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010165-M01, RRID:AB_622385
- Product name
- SLC25A13 monoclonal antibody (M01), clone 4F4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant SLC25A13.
- Antigen sequence
AAAKVALTKRADPAELRTIFLKYASIEKNGEFFMS
PNDFVTRYLNIFGESQPNPKTVELLSGVVDQTKDG
LISFQEFVA- Isotype
- IgG
- Antibody clone number
- 4F4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- SLC25A13 monoclonal antibody (M01), clone 4F4 Western Blot analysis of SLC25A13 expression in HepG2 ( Cat # L019V1 ).
- Protocol
- Protocol
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of SLC25A13 expression in transfected 293T cell line by SLC25A13 monoclonal antibody (M01), clone 4F4.Lane 1: SLC25A13 transfected lysate(74.2 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged SLC25A13 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to SLC25A13 on HepG2 cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
