HPA050656

antibody from Atlas Antibodies

Targeting: PBK CT84, FLJ14385, Nori-3, SPK, TOPK

Antibody data

Submit

Validation data

Product number: HPA050656 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA050656, RRID:AB_2681205
Product name: Anti-PBK
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: ISNFKTPSKLSEKKKSVLCSTPTINIPASPFMQKL GFGTGVNVYLMKRSPRGLSHSPWAVKKINPICNDH YRSVYQKRLMDEAKILKSLHHPNIVGYRAFTEAND GSLCLAMEYGGEKSLNDLIEERYKASQD
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

PBK protein structure - HPA050656 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human testis and endometrium tissues using Anti-PBK antibody. Corresponding PBK RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human colon, kidney, liver and testis using Anti-PBK antibody HPA050656 (A) shows similar protein distribution across tissues to independent antibody HPA005753 (B).
Antibody #2 product nr: HPA005753
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows strong nuclear and cytoplasmic positivity in cells in seminiferous ducts.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human endometrium shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-PBK antibody HPA050656.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver using Anti-PBK antibody HPA050656.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-PBK antibody HPA050656.
Sample type: HUMAN