Antibody data

Product number
PAB28387
Provider
Abnova Corporation
Product name
ASB2 polyclonal antibody
Provider product page
Abnova Corporation - PAB28387
Antibody type
Polyclonal
Antigen
Recombinant protein corresponding to amino acids of human ASB2.
Reactivity
Human
Host
Rabbit
Antigen sequence
FHSCSAPSRSTAPPESSPARAPMGLFQGVMQKYSS
SLFKTSQLAPADPLIKAIKDGDEEALKTMIKEGKN
LAEPNKEGWLPLHEAAYYGQVGCLKVLQRAYPGTI
DQRTLQEETAVYLATCRGHLDCLLSLLQAGAEPDI
SNK
Isotype
IgG
Vial size
100 µl
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.